Recombinant Rat Tpsab1 protein, His-SUMO & Myc-tagged
Cat.No. : | Tpsab1-3614R |
Product Overview : | Recombinant Rat Tpsab1 protein(P27435)(29-273aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 29-273aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.4 kDa |
AA Sequence : | IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Tpsab1 tryptase alpha/beta 1 [ Rattus norvegicus ] |
Official Symbol | Tpsab1 |
Synonyms | TPSAB1; tryptase alpha/beta 1; tryptase; MMCP-7; tryptase, skin; tryptase beta 1; mast cell protease 7; tryptase alpha/beta-1; Mcpt7; TPSB1; rMCP-7; |
Gene ID | 54271 |
mRNA Refseq | NM_019322 |
Protein Refseq | NP_062195 |
◆ Recombinant Proteins | ||
TPSAB1-1579C | Recombinant Cynomolgus TPSAB1 protein, His-tagged | +Inquiry |
TPSAB1-6507H | Recombinant Human TPSAB1 Protein (Met1-Val133, Ser135-Gly199, Asp201-Pro275), C-His tagged | +Inquiry |
TPSAB1-13HFL | Active Recombinant Full Length Human tryptase alpha/beta 1 Protein, His tagged | +Inquiry |
Tpsab1-1462R | Recombinant Rat Tpsab1 protein, His-tagged | +Inquiry |
TPSAB1-7161H | Recombinant Human Tryptase Alpha/Beta 1, His-tagged | +Inquiry |
◆ Native Proteins | ||
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPSAB1-1815HCL | Recombinant Human TPSAB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tpsab1 Products
Required fields are marked with *
My Review for All Tpsab1 Products
Required fields are marked with *