Recombinant Rat Tshb Protein, His/Myc-tagged

• Cat.No.: Tshb-30R
• Product Overview: Recombinant Rat Tshb(21-132aa) fused with His tag at the N-terminus and Myc tag at the C-terminus was produced in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 21-132aa
• Form: 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol.
• Molecular Mass: 19.9 kDa
• AA sequence: FCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFTYRTVEIPGCPHH
  VAPYFSYPVALSCKCGKCNTDYSDCTHEAVKTNYCTKPQTFY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Stability: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
  Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: 0.1mg/ml

Gene Information

• Gene Name: Tshb thyroid stimulating hormone, beta [ Rattus norvegicus ]
• Official Symbol: Tshb
• Synonyms: TSHB; thyroid stimulating hormone, beta; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; thyroid stimulating hormone, beta subunit
• Gene ID: 25653
• mRNA Refseq: NM_013116
• Protein Refseq: NP_037248
• UniProt ID: P04652