Recombinant Rat Tshb Protein, His/Myc-tagged
Cat.No. : | Tshb-30R |
Product Overview : | Recombinant Rat Tshb(21-132aa) fused with His tag at the N-terminus and Myc tag at the C-terminus was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-132aa |
Form : | 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol. |
Molecular Mass : | 19.9 kDa |
AA sequence : | FCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFTYRTVEIPGCPHH VAPYFSYPVALSCKCGKCNTDYSDCTHEAVKTNYCTKPQTFY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Stability : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | 0.1mg/ml |
Gene Name | Tshb thyroid stimulating hormone, beta [ Rattus norvegicus ] |
Official Symbol | Tshb |
Synonyms | TSHB; thyroid stimulating hormone, beta; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; thyroid stimulating hormone, beta subunit; |
Gene ID | 25653 |
mRNA Refseq | NM_013116 |
Protein Refseq | NP_037248 |
UniProt ID | P04652 |
◆ Recombinant Proteins | ||
TSH-105H | Recombinant Human Thyroid Stimulating Hormone | +Inquiry |
Tshb-6684M | Recombinant Mouse Tshb Protein, Myc/DDK-tagged | +Inquiry |
TSHB-105H | Active Recombinant Human TSHB+TSHA co-expressed protein | +Inquiry |
TSHB-2417R | Recombinant Rat TSHB Protein (21-132 aa), His-Myc-tagged | +Inquiry |
Tshb-496R | Recombinant Rat Tshb Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tshb Products
Required fields are marked with *
My Review for All Tshb Products
Required fields are marked with *