"Tshb" Related Products

Expand
Expand

Recombinant Rat Tshb Protein, His/Myc-tagged

Cat.No. : Tshb-30R
Product Overview : Recombinant Rat Tshb(21-132aa) fused with His tag at the N-terminus and Myc tag at the C-terminus was produced in E. coli.
Source : E. coli
Species : Rat
Tag : His/Myc
Form : 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol.
Molecular Mass : 19.9 kDa
Protein length : 21-132aa
AA sequence : FCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFTYRTVEIPGCPHH
VAPYFSYPVALSCKCGKCNTDYSDCTHEAVKTNYCTKPQTFY
Purity : Greater than 85% as determined by SDS-PAGE.
Stability : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : 0.1mg/ml
Figure :

Gene Name : Tshb thyroid stimulating hormone, beta [ Rattus norvegicus ]
Official Symbol : Tshb
Synonyms : TSHB; thyroid stimulating hormone, beta; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; thyroid stimulating hormone, beta subunit;
Gene ID : 25653
mRNA Refseq : NM_013116
Protein Refseq : NP_037248
UniProt ID : P04652

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.