Recombinant Rhesus cytomegalovirus (strain 68-1) gB protein, His&Myc-tagged
| Cat.No. : | gB-3800R |
| Product Overview : | Recombinant Rhesus cytomegalovirus (strain 68-1) gB protein(P89053)(745-854aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus cytomegalovirus |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 745-854aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18 kDa |
| AA Sequence : | MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| gB-1999H | Recombinant HHV-2 gB Full Length Transmembrane protein, His-tagged | +Inquiry |
| gB-502V | Recombinant HSV-1 gB Protein, His & Myc-tagged | +Inquiry |
| GB-356H | Recombinant HCMV GB protein, His-tagged | +Inquiry |
| gB-501V | Recombinant HSV-1 gB Protein | +Inquiry |
| gB-112C | Active Recombinant Human cytomegalovirus gB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GB-2601CCL | Recombinant CMV GB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All gB Products
Required fields are marked with *
My Review for All gB Products
Required fields are marked with *



