Recombinant Rhesus macaque APOE protein, His-tagged
Cat.No. : | APOE-4562R |
Product Overview : | Recombinant Rhesus macaque APOE protein(Q28502)(19-295 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-295 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 38.6 kDa |
AASequence : | KVEQPVEPETEPELRQQAEGQSGQPWELALGRFWDYLRWVQTLSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLARLGPLVEQGRVRAATVGSLASQPLQERAQAKLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQISLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGASTAPVPSDNH |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
APOE-17H | Recombinant Human APOE Protein, His-tagged | +Inquiry |
APOE-0240H | Recombinant Human APOE protein, Trx-tagged, Biotinylated | +Inquiry |
APOE-6186D | Recombinant Dog APOE protein(19-323aa), His&Myc-tagged | +Inquiry |
APOE-2542R | Recombinant Rabbit APOE protein, His-B2M & Myc-tagged | +Inquiry |
APOE-1377H | Active Recombinant Human APOE Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ApoE-3560H | Native Human ApoE | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
0
Inquiry Basket