Recombinant Rhesus Macaque CXCL8 Protein (79 aa)

• Cat.No.: CXCL8-002C
• Product Overview: Recombinant Rhesus Macaque CXCL8 Protein without tag was expressed in E. coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Protein Length: 79
• Description: Interleukin-8 (C-X-C motif chemokine 8) is coded by the interleukin 8 gene on the chromosome 5 in Rhesus macaque (Macaca mulatta), which is not only 94% identical to human IL-8 but also structurally and functionally similar with the human equivalent. Provide a valuable resource for a primate model of inflammation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Data not available
• Molecular Mass: Approximately 9.14kD containing 79 amino acid residues.
• AA Sequence: AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP
• Endotoxin: Less than 1 EU/μg of rRhIL-8 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CXCL8 C-X-C motif chemokine ligand 8 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: CXCL8
• Synonyms: CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
• Gene ID: 613028
• mRNA Refseq: NM_001032965
• Protein Refseq: NP_001028137
• UniProt ID: P51495