Recombinant Rhesus Macaque CXCL8 Protein (79 aa)

Cat.No. : CXCL8-002C
Product Overview : Recombinant Rhesus Macaque CXCL8 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Protein Length : 79
Description : Interleukin-8 (C-X-C motif chemokine 8) is coded by the interleukin 8 gene on the chromosome 5 in Rhesus macaque (Macaca mulatta), which is not only 94% identical to human IL-8 but also structurally and functionally similar with the human equivalent. Provide a valuable resource for a primate model of inflammation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Data not available
Molecular Mass : Approximately 9.14kD containing 79 amino acid residues.
AA Sequence : AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP
Endotoxin : Less than 1 EU/μg of rRhIL-8 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CXCL8 C-X-C motif chemokine ligand 8 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol CXCL8
Synonyms CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
Gene ID 613028
mRNA Refseq NM_001032965
Protein Refseq NP_001028137
UniProt ID P51495

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL8 Products

Required fields are marked with *

My Review for All CXCL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon