Recombinant Rhesus macaque GH1 protein, His&Myc-tagged
Cat.No. : | GH1-4643R |
Product Overview : | Recombinant Rhesus macaque GH1 protein(P33093)(27-217aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 27-217aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNNDALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF |
◆ Recombinant Proteins | ||
GH1-951P | Recombinant Pig GH1 protein, His&hFc-tagged | +Inquiry |
GH1-948C | Recombinant Cattle GH1 Protein, His-tagged | +Inquiry |
GH1-382H | Recombinant Human Growth Hormone 1, His-tagged | +Inquiry |
GH1-055H | Recombinant Human GH1 Protein | +Inquiry |
GH1-6856H | Recombinant Human GH1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *