Recombinant Rhesus Monkey CLEC9A Protein, His-tagged

• Cat.No.: CLEC9A-1794R
• Product Overview: CLEC9A;C-type lectin domain family 9 member A;DNGR-1;CD370;His-tagged;Rhesus Monkey

Specification

• Species: Rhesus Monkey
• Source: Baculovirus-Insect Cells
• Tag: His
• Protein Length: 55-241 aa
• Description: CLEC9A (C-type lectin domain family 9 member A), also known as DNGR-1, functions as an endocytic receptor on a small subset of myeloid cells specialized for the uptake and processing of material from dead cells. It is involved in cross-presentation of dead-cell associated antigens.
• Form: Liquid
• Molecular Mass: 23 kDa (confirmed by SDS-PAGE)
• AASequence: MGVKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSHVLQMKFCQTFMQSSFSSAHNCSPCPNNWIQNRESCYYVSEHWKIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIRGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPVEISQSTNQVCGYIKNSSLLSSNCSTWKYFICEKYALRSSVHHHHHHHHHH
• Endotoxin: <1.0 EU/ug (by LAL)
• Purity: >90% (by SDS-PAGE)
• Storage: -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles
• Concentration: 1.27 mg/ml (by BCA)
• mRNA Refseq-Weblink: 717472
• MIM-Weblink: DNGR-1;CD370;DNGR1
• Reference: PMID: 25319552
• Storage Buffer: Sterile PBS, pH7.4, 0.5% SKL

Gene Information

• Gene Name: CLEC9A
• Official Symbol: NM_001194664.4
• Synonyms: NP_001181593.4
• Gene ID: https://www.ncbi.nlm.nih.gov/protein/NP_001181593.4
• Protein Refseq: https://www.ncbi.nlm.nih.gov/gene/717472