Recombinant Rhesus Monkey CLEC9A Protein, His-tagged
| Cat.No. : | CLEC9A-1794R |
| Product Overview : | CLEC9A;C-type lectin domain family 9 member A;DNGR-1;CD370;His-tagged;Rhesus Monkey |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus Monkey |
| Source : | Baculovirus-Insect Cells |
| Tag : | His |
| Protein Length : | 55-241 aa |
| Description : | CLEC9A (C-type lectin domain family 9 member A), also known as DNGR-1, functions as an endocytic receptor on a small subset of myeloid cells specialized for the uptake and processing of material from dead cells. It is involved in cross-presentation of dead-cell associated antigens. |
| Form : | Liquid |
| Molecular Mass : | 23 kDa (confirmed by SDS-PAGE) |
| AASequence : | MGVKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSHVLQMKFCQTFMQSSFSSAHNCSPCPNNWIQNRESCYYVSEHWKIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIRGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPVEISQSTNQVCGYIKNSSLLSSNCSTWKYFICEKYALRSSVHHHHHHHHHH |
| Endotoxin : | <1.0 EU/ug (by LAL) |
| Purity : | >90% (by SDS-PAGE) |
| Storage : | -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles |
| Concentration : | 1.27 mg/ml (by BCA) |
| mRNA Refseq-Weblink : | 717472 |
| MIM-Weblink : | DNGR-1;CD370;DNGR1 |
| Reference : | PMID: 25319552 |
| Storage Buffer : | Sterile PBS, pH7.4, 0.5% SKL |
| Gene Name | CLEC9A |
| Official Symbol | NM_001194664.4 |
| Synonyms | NP_001181593.4 |
| Gene ID | https://www.ncbi.nlm.nih.gov/protein/NP_001181593.4 |
| Protein Refseq | https://www.ncbi.nlm.nih.gov/gene/717472 |
| ◆ Recombinant Proteins | ||
| CLEC9A-1474H | Recombinant Human CLEC9A Protein, GST-tagged | +Inquiry |
| CLEC9A-908R | Recombinant Rhesus monkey CLEC9A Protein, His-tagged | +Inquiry |
| CLEC9A-2092H | Recombinant Human CLEC9A Protein (Lys57-Val241), C-His tagged | +Inquiry |
| CLEC9A-1446R | Recombinant Rat CLEC9A Protein | +Inquiry |
| CLEC9A-1795R | Recombinant Rhesus Monkey CLEC9A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC9A-363HCL | Recombinant Human CLEC9A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC9A Products
Required fields are marked with *
My Review for All CLEC9A Products
Required fields are marked with *
