Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein, His-tagged
Cat.No. : | LECT2-2494R |
Product Overview : | Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein (19-151 aa) with His tag was expressed in HEK293. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-151 aa |
Description : | This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. |
Tag : | His |
Molecular Mass : | 16 kDa |
AA Sequence : | GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPVKKGEKLGTLLPLQKVYPGIQSHVHIENCDLSDPTAYLHHHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.14 mg/mL by BCA |
Gene Name | LECT2 leukocyte cell derived chemotaxin 2 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | LECT2 |
Synonyms | LECT2; leukocyte cell derived chemotaxin 2; leukocyte cell-derived chemotaxin-2 |
Gene ID | 712424 |
mRNA Refseq | NM_001194884 |
Protein Refseq | NP_001181813 |
UniProt ID | F6VHJ2 |
◆ Recombinant Proteins | ||
LECT2-2286H | Recombinant Human LECT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lect2-264M | Recombinant Mouse Lect2 Protein, His-tagged | +Inquiry |
Lect2-1309M | Recombinant Mouse Lect2 Protein, MYC/DDK-tagged | +Inquiry |
LECT2-7027C | Recombinant Chicken LECT2 | +Inquiry |
LECT2-2494R | Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LECT2-4779HCL | Recombinant Human LECT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LECT2 Products
Required fields are marked with *
My Review for All LECT2 Products
Required fields are marked with *