Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein, His-tagged

• Cat.No.: LECT2-2494R
• Product Overview: Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein (19-151 aa) with His tag was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: His
• Protein Length: 19-151 aa
• Description: This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis.
• Tag: His
• Molecular Mass: 16 kDa
• AA Sequence: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPVKKGEKLGTLLPLQKVYPGIQSHVHIENCDLSDPTAYLHHHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.14 mg/mL by BCA

Gene Information

• Gene Name: LECT2 leukocyte cell derived chemotaxin 2 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: LECT2
• Synonyms: LECT2; leukocyte cell derived chemotaxin 2; leukocyte cell-derived chemotaxin-2
• Gene ID: 712424
• mRNA Refseq: NM_001194884
• Protein Refseq: NP_001181813
• UniProt ID: F6VHJ2