Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein, His-tagged

Cat.No. : LECT2-2494R
Product Overview : Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein (19-151 aa) with His tag was expressed in HEK293.
Availability July 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : His
Protein Length : 19-151 aa
Description : This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis.
Tag : His
Molecular Mass : 16 kDa
AA Sequence : GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPVKKGEKLGTLLPLQKVYPGIQSHVHIENCDLSDPTAYLHHHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.14 mg/mL by BCA
Gene Name LECT2 leukocyte cell derived chemotaxin 2 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol LECT2
Synonyms LECT2; leukocyte cell derived chemotaxin 2; leukocyte cell-derived chemotaxin-2
Gene ID 712424
mRNA Refseq NM_001194884
Protein Refseq NP_001181813
UniProt ID F6VHJ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LECT2 Products

Required fields are marked with *

My Review for All LECT2 Products

Required fields are marked with *

0
cart-icon