Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein, His-tagged
| Cat.No. : | LECT2-2494R |
| Product Overview : | Recombinant Rhesus monkey leukocyte cell derived chemotaxin 2 Protein (19-151 aa) with His tag was expressed in HEK293. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-151 aa |
| Description : | This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. |
| Tag : | His |
| Molecular Mass : | 16 kDa |
| AA Sequence : | GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPVKKGEKLGTLLPLQKVYPGIQSHVHIENCDLSDPTAYLHHHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.14 mg/mL by BCA |
| Gene Name | LECT2 leukocyte cell derived chemotaxin 2 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | LECT2 |
| Synonyms | LECT2; leukocyte cell derived chemotaxin 2; leukocyte cell-derived chemotaxin-2 |
| Gene ID | 712424 |
| mRNA Refseq | NM_001194884 |
| Protein Refseq | NP_001181813 |
| UniProt ID | F6VHJ2 |
| ◆ Recombinant Proteins | ||
| LECT2-1261H | Recombinant Human LECT2 protein, His-tagged | +Inquiry |
| Lect2-264M | Recombinant Mouse Lect2 Protein, His-tagged | +Inquiry |
| LECT2-7594HFL | Recombinant Full Length Human LECT2 protein, Flag-tagged | +Inquiry |
| LECT2-2390H | Recombinant Human LECT2 Protein, His-tagged | +Inquiry |
| Lect2-1309M | Recombinant Mouse Lect2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LECT2-4779HCL | Recombinant Human LECT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LECT2 Products
Required fields are marked with *
My Review for All LECT2 Products
Required fields are marked with *
