Recombinant Rhesus monkey LILRB4 Protein, His-tagged
| Cat.No. : | LILRB4-32R |
| Product Overview : | Recombinant Rhesus monkey LILRB4 Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | HEK293 |
| Tag : | His |
| Description : | leukocyte immunoglobulin like receptor B4 |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | 26.36 kDa |
| AA Sequence : | GPLPKPTIWAEPGSVISWGSPVTIWCQGTLDAQEYYLDKEGSPAPWDTQNPLEPRNKAKFSIPSMTQHYAGRYRCYYHSHPDWSEDSDPLDLVMTGAYSKPILSVLPSPLVTSGESVTLLCQSQSPMDTFLLFKEGAAHPLPRLRSQHGAQLHWAEFPMGPVTSVHGGTYRCISSRSFSHYLLSRPSDPVELTVLGSLESPSPSPTRSISAAGPEDQSLMPTGSDPQSGLRRHHHHHHH |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.27mg/ml |
| Gene Name | LILRB4 leukocyte immunoglobulin like receptor B4 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | LILRB4 |
| Synonyms | LILRBC |
| Gene ID | 692336 |
| mRNA Refseq | NM_001040676 |
| Protein Refseq | NP_001035766 |
| UniProt ID | A0A5F7ZGE5 |
| ◆ Recombinant Proteins | ||
| LILRB4-2518R | Recombinant Rhesus monkey LILRB4 Protein, His-tagged | +Inquiry |
| Lilrb4-362M | Recombinant Mouse Lilrb4 Protein, His-tagged | +Inquiry |
| LILRB4-359C | Recombinant Cynomolgus monkey LILRB4 Protein, His-tagged | +Inquiry |
| LILRB4-5081M | Recombinant Mouse LILRB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LILRB4-0338H | Active Recombinant Human LILRB4 protein, His-tagged, FITC-Labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LILRB4-380HCL | Recombinant Human LILRB4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB4 Products
Required fields are marked with *
My Review for All LILRB4 Products
Required fields are marked with *
