Recombinant Rhesus monkey LILRB4 Protein, His-tagged

Cat.No. : LILRB4-32R
Product Overview : Recombinant Rhesus monkey LILRB4 Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : His
Description : leukocyte immunoglobulin like receptor B4
Form : PBS, pH 7.4.
Molecular Mass : 26.36 kDa
AA Sequence : GPLPKPTIWAEPGSVISWGSPVTIWCQGTLDAQEYYLDKEGSPAPWDTQNPLEPRNKAKFSIPSMTQHYAGRYRCYYHSHPDWSEDSDPLDLVMTGAYSKPILSVLPSPLVTSGESVTLLCQSQSPMDTFLLFKEGAAHPLPRLRSQHGAQLHWAEFPMGPVTSVHGGTYRCISSRSFSHYLLSRPSDPVELTVLGSLESPSPSPTRSISAAGPEDQSLMPTGSDPQSGLRRHHHHHHH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.27mg/ml
Gene Name LILRB4 leukocyte immunoglobulin like receptor B4 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol LILRB4
Synonyms LILRBC
Gene ID 692336
mRNA Refseq NM_001040676
Protein Refseq NP_001035766
UniProt ID A0A5F7ZGE5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LILRB4 Products

Required fields are marked with *

My Review for All LILRB4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon