Recombinant Rhesus monkey LILRB4 Protein, His-tagged

• Cat.No.: LILRB4-32R
• Product Overview: Recombinant Rhesus monkey LILRB4 Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: His
• Description: leukocyte immunoglobulin like receptor B4
• Form: PBS, pH 7.4.
• Molecular Mass: 26.36 kDa
• AA Sequence: GPLPKPTIWAEPGSVISWGSPVTIWCQGTLDAQEYYLDKEGSPAPWDTQNPLEPRNKAKFSIPSMTQHYAGRYRCYYHSHPDWSEDSDPLDLVMTGAYSKPILSVLPSPLVTSGESVTLLCQSQSPMDTFLLFKEGAAHPLPRLRSQHGAQLHWAEFPMGPVTSVHGGTYRCISSRSFSHYLLSRPSDPVELTVLGSLESPSPSPTRSISAAGPEDQSLMPTGSDPQSGLRRHHHHHHH
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.27mg/ml

Gene Information

• Gene Name: LILRB4 leukocyte immunoglobulin like receptor B4 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: LILRB4
• Synonyms: LILRBC
• Gene ID: 692336
• mRNA Refseq: NM_001040676
• Protein Refseq: NP_001035766
• UniProt ID: A0A5F7ZGE5