Recombinant Rhesus monkey oncostatin M Protein

Cat.No. : OSM-3255R
Product Overview : Recombinant Rhesus monkey oncostatin M Protein without tag was expressed in Mammalian cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : Mammalian Cells
Tag : Non
Description : This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Molecular Mass : ~ 26.6 kDa
AA Sequence : MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR
Endotoxin : < 1 EU/μg by LAL.
Purity : ≥95 % by SDS-PAGE
Storage : Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles.
Storage Buffer : 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50 % glycerol
Concentration : 0.7 mg/mL
Gene Name OSM oncostatin M [ Macaca mulatta (Rhesus monkey) ]
Official Symbol OSM
Synonyms OSM; oncostatin M; oncostatin-M;
Gene ID 717994
mRNA Refseq NM_001194474
Protein Refseq NP_001181403
UniProt ID F7GF43

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSM Products

Required fields are marked with *

My Review for All OSM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon