| Species : |
Rhesus macaque |
| Source : |
Mammalian Cells |
| Tag : |
Non |
| Description : |
This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
| Molecular Mass : |
~ 26.6 kDa |
| AA Sequence : |
MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR |
| Endotoxin : |
< 1 EU/μg by LAL. |
| Purity : |
≥95 % by SDS-PAGE |
| Storage : |
Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles. |
| Storage Buffer : |
0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50 % glycerol |
| Concentration : |
0.7 mg/mL |
