Recombinant Rhesus monkey oncostatin M Protein
Cat.No. : | OSM-3255R |
Product Overview : | Recombinant Rhesus monkey oncostatin M Protein without tag was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | Mammalian Cells |
Tag : | Non |
Description : | This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
Molecular Mass : | ~ 26.6 kDa |
AA Sequence : | MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | ≥95 % by SDS-PAGE |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles. |
Storage Buffer : | 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50 % glycerol |
Concentration : | 0.7 mg/mL |
Gene Name | OSM oncostatin M [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | OSM |
Synonyms | OSM; oncostatin M; oncostatin-M; |
Gene ID | 717994 |
mRNA Refseq | NM_001194474 |
Protein Refseq | NP_001181403 |
UniProt ID | F7GF43 |
◆ Recombinant Proteins | ||
OSM-513H | Recombinant Human OSM protein | +Inquiry |
Osm-10606M | Recombinant Mouse Osm Protein, His (Fc)-Avi-tagged | +Inquiry |
Osm-4527R | Recombinant Rat Osm protein, His-tagged | +Inquiry |
OSM-321O | Active Recombinant Human OSM Protein (228 aa) | +Inquiry |
OSM-31H | Recombinant Human OSM Protein | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *