Recombinant Rickettsia Japonica OMP Protein (20-159 aa), His-SUMO-tagged

• Cat.No.: OMP-2115R
• Product Overview: Recombinant Rickettsia Japonica (strain ATCC VR-1363/YH) OMP Protein (20-159 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rickettsia Japonica
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 20-159 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 30.5 kDa
• AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: omp
• UniProt ID: Q52764