Recombinant Rickettsia Japonica OMP Protein (20-159 aa), His-SUMO-tagged
Cat.No. : | OMP-2115R |
Product Overview : | Recombinant Rickettsia Japonica (strain ATCC VR-1363/YH) OMP Protein (20-159 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia Japonica |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-159 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 30.5 kDa |
AA Sequence : | CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | omp; |
UniProt ID | Q52764 |
◆ Recombinant Proteins | ||
OMP-355H | Recombinant Human OMP protein, His-tagged | +Inquiry |
OMP-7590H | Recombinant Human OMP, His-tagged | +Inquiry |
OMP-1457H | Recombinant Human OMP, GST-tagged | +Inquiry |
omp-4151R | Recombinant Rickettsia rickettsii omp protein, His&Myc-tagged | +Inquiry |
omp-1278R | Recombinant Rickettsia rickettsii omp protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OMP-1250HCL | Recombinant Human OMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OMP Products
Required fields are marked with *
My Review for All OMP Products
Required fields are marked with *