Recombinant S. aureus NI36_RS11960 Protein, His-tagged

Cat.No. : NI36_RS11960-1242S
Product Overview : Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B Protein (26-325aa) was expressed in E. coil with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.aureus
Source : E.coli
Tag : His
Protein Length : 26-325 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 38.1 kDa
AA Sequence : AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name NI36_RS11960 gamma-hemolysin component B [ Staphylococcus aureus ]
Official Symbol NI36_RS11960
Synonyms NI36_RS11960; gamma-hemolysin component B; hlgB
Gene ID 31215165
UniProt ID P0A075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NI36_RS11960 Products

Required fields are marked with *

My Review for All NI36_RS11960 Products

Required fields are marked with *

0
cart-icon