Recombinant S. aureus SAOUHSC_01121 Protein, His-tagged
| Cat.No. : | SAOUHSC_01121-1243S |
| Product Overview : | Recombinant Staphylococcus aureus (strain NCTC 8325) SAOUHSC_01121 Protein (27-319aa) was expressed in Yeast with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | S.aureus |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-319 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 35.3 kDa |
| AA Sequence : | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | SAOUHSC_01121 alpha-hemolysin [ Staphylococcus aureus subsp. aureus NCTC 8325 ] |
| Official Symbol | SAOUHSC_01121 |
| Synonyms | SAOUHSC_01121; hly; Alpha-hemolysin; Alpha-HL; Alpha-toxin; hla |
| Gene ID | 3920722 |
| UniProt ID | Q2G1X0 |
| ◆ Recombinant Proteins | ||
| SAOUHSC_01121-1243S | Recombinant S. aureus SAOUHSC_01121 Protein, His-tagged | +Inquiry |
| SAOUHSC-01121-0004S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01121 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAOUHSC_01121 Products
Required fields are marked with *
My Review for All SAOUHSC_01121 Products
Required fields are marked with *
Recently Viewed
