Recombinant S. enterica OmpA family protein Protein, His/MYC-tagged
| Cat.No. : | OmpA-1309H |
| Product Overview : | Recombinant Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958 OmpA family protein Protein (82-220aa) was expressed in E. coli with N-terminal His tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | S.enterica |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 82-220 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 18.6 kDa |
| AA Sequence : | DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGY TDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | OmpA family protein |
| Official Symbol | OmpA family protein |
| Synonyms | OmpA family protein; OmpA |
| UniProt ID | S4JJH7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OmpA family protein Products
Required fields are marked with *
My Review for All OmpA family protein Products
Required fields are marked with *
