Recombinant Salmonella Typhi AROD Protein (1-252 aa), His-tagged
Cat.No. : | AROD-1587S |
Product Overview : | Recombinant Salmonella Typhi AROD Protein (1-252 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella Typhi |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-252 aa |
Description : | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | aroD; Type I DHQase; |
UniProt ID | P24670 |
◆ Recombinant Proteins | ||
AROD-1587S | Recombinant Salmonella Typhi AROD Protein (1-252 aa), His-tagged | +Inquiry |
AROD-899S | Recombinant Salmonella Typhi AROD Protein (1-252 aa), His-SUMO-tagged | +Inquiry |
AROD-2525B | Recombinant Bacillus subtilis AROD protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AROD Products
Required fields are marked with *
My Review for All AROD Products
Required fields are marked with *
0
Inquiry Basket