Recombinant Salmonella Typhi HUPB Protein (1-90 aa), His-SUMO-Myc-tagged

• Cat.No.: HUPB-2156S
• Product Overview: Recombinant Salmonella Typhi HUPB Protein (1-90 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Salmonella Typhi
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 1-90 aa
• Description: Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 29.2 kDa
• AA Sequence: MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: hupB; HU-1 NS1
• UniProt ID: P0A1R9