Recombinant SARS-CoV-2 ORF8 Protein, His-SUMO-tagged(N-ter)

Cat.No. : ORF8-263S
Product Overview : Recombinant SARS-CoV-2 ORF8 Protein with His-SUMO tag (N-ter) was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : SARS-CoV-2
Source : HEK293
Tag : His&SUMO
Description : Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.
Form : Powder
AA Sequence : FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name ORF8 ORF8 protein [ Severe acute respiratory syndrome coronavirus 2 ]
Official Symbol ORF8
Synonyms ORF8; ORF8 protein;
Gene ID 43740577
Protein Refseq YP_009724396
UniProt ID P0DTC8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ORF8 Products

Required fields are marked with *

My Review for All ORF8 Products

Required fields are marked with *

0
cart-icon