Active Recombinant SARS-CoV-2 RBD Protein, His-tagged

Cat.No. : RBD-001S
Product Overview : Purified recombinant fusion protein that includes the RBD of SARS-CoV-2 Spike protein (S-Protein) and Virion Surface Domain of Membrane Protein (M-protein) with C-terminal HIS-tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : SARS-CoV-2
Source : HEK293
Tag : His
Bio-activity : Binding of SARS-CoV-2 S-M Fusion Protein to Human ACE2: 2 ug/ml of SARS-CoV-2 Spike and Membrane viral fusion protein (gel insert) was immobilized on an ELISA plate and its ability to bind to Human ACE2 was measured. The EC50 was between 10-20 ng/ml.
Molecular Mass : 34 kDa
AA Sequence : MALWIDRMQLLSCIALSLALVTNSAKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLGGGSGGGSMADSNGTITVEELKKHHHHHH
Purity : > 90% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 μg/mL as determined by Bradford protein assay method.
Storage Buffer : PBS, 10% glycerol.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBD Products

Required fields are marked with *

My Review for All RBD Products

Required fields are marked with *

0
cart-icon