Active Recombinant SARS-CoV-2 RBD Protein, His-tagged

• Cat.No.: RBD-001S
• Product Overview: Purified recombinant fusion protein that includes the RBD of SARS-CoV-2 Spike protein (S-Protein) and Virion Surface Domain of Membrane Protein (M-protein) with C-terminal HIS-tag was expressed in HEK293.

Specification

• Species: SARS-CoV-2
• Source: HEK293
• Tag: His
• Bio-activity: Binding of SARS-CoV-2 S-M Fusion Protein to Human ACE2: 2 ug/ml of SARS-CoV-2 Spike and Membrane viral fusion protein (gel insert) was immobilized on an ELISA plate and its ability to bind to Human ACE2 was measured. The EC50 was between 10-20 ng/ml.
• Molecular Mass: 34 kDa
• AA Sequence: MALWIDRMQLLSCIALSLALVTNSAKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLGGGSGGGSMADSNGTITVEELKKHHHHHH
• Purity: > 90% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 μg/mL as determined by Bradford protein assay method.
• Storage Buffer: PBS, 10% glycerol.