Recombinant SARS-CoV Spike protein, His&Myc-tagged
Cat.No. : | Spike-4545S |
Product Overview : | Recombinant SARS-CoV Spike protein(P59594)(306-527aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | SARS-CoV |
Source : | Mammalian Cells |
Tag : | His&Myc |
Protein Length : | 306-527aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30 kDa |
AA Sequence : | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
Spike-373V | Recombinant 2019-nCoV Spike S1(T20N, D614G) Protein, His-tagged | +Inquiry |
Spike-4731V | Active Recombinant COVID-19 Spike RBD protein, His-tagged | +Inquiry |
Spike-4717V | Active Recombinant COVID-19 Spike protein RBD (K417T), His-tagged | +Inquiry |
Spike-1265V | Recombinant COVID-19 Spike RBD(G482S) protein(Arg319-Phe541), His-tagged | +Inquiry |
Spike-329V | Recombinant COVID-19 Spike RBD (K378N) protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spike-1741HCL | Recombinant Human coronavirus Spike cell lysate | +Inquiry |
Spike-001HCL | Recombinant HCoV-EMC/2012 Spike cell lysate | +Inquiry |
Spike-001SCL | Recombinant SARS Spike cell lysate | +Inquiry |
Spike-1058HCL | Recombinant HCoV-EMC/2012 Spike cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Spike Products
Required fields are marked with *
My Review for All Spike Products
Required fields are marked with *