Recombinant Semliki forest virus (SFV) Poly protein, His&Myc-tagged
| Cat.No. : | Poly-573S |
| Product Overview : | Recombinant Semliki forest virus Polyprotein P1234(P08411)(29-260aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Semliki forest virus (SFV) |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 29-260aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ESLQVTPNDHANARAFSHLATKLIEQETDKDTLILDIGSAPSRRMMSTHKYHCVCPMRSAEDPERLVCYAKKLAAASGKVLDREIAGKITDLQTVMATPDAESPTFCLHTDVTCRTAAEVAVYQDVYAVHAPTSLYHQAMKGVRTAYWIGFDTTPFMFDALAGAYPTYATNWADEQVLQARNIGLCAASLTEGRLGKLSILRKKQLKPCDTVMFSVGSTLYTESRKLLRSWH |
| ◆ Recombinant Proteins | ||
| Envelope 1-13D | Recombinant Dengue 1 Envelope Protein, 6×His tagged | +Inquiry |
| POLY-297Z | Recombinant Zika virus POLY Protein (Asp791-Ser1144), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| Envelope 3-19D | Recombinant Dengue 3 Envelope Protein | +Inquiry |
| poly-5765S | Recombinant Sindbis virus Non-structural polyprotein, His-tagged | +Inquiry |
| D3-02D | Recombinant DENV3 envelope (strain H87) protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Poly Products
Required fields are marked with *
My Review for All Poly Products
Required fields are marked with *




