"GHRH" Related Products

Expand
Expand
Expand

Recombinant Sheep GHRH Protein (1-44 aa), GST-tagged

Cat.No. : GHRH-523S
Product Overview : Recombinant Sheep GHRH Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
Description : GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Source : E. coli
Species : Sheep
Tag : GST
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 32.1 kDa
Protein length : 1-44 aa
AA Sequence : YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : GHRH growth hormone releasing hormone [ Ovis aries (sheep) ]
Official Symbol : GHRH
Synonyms : GRF;
Gene ID : 100101237
UniProt ID : P07217

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.