Recombinant Sheep GHRH Protein (1-44 aa), GST-tagged
Cat.No. : | GHRH-523S |
Product Overview : | Recombinant Sheep GHRH Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-44 aa |
Description : | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 32.1 kDa |
AA Sequence : | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | GHRH growth hormone releasing hormone [ Ovis aries (sheep) ] |
Official Symbol | GHRH |
Synonyms | GRF; |
Gene ID | 100101237 |
UniProt ID | P07217 |
◆ Recombinant Proteins | ||
GHRH-2869H | Recombinant Human GHRH Protein (Cys19-Gly108), N-GST tagged | +Inquiry |
GHRH-2185R | Recombinant Rat GHRH Protein, His (Fc)-Avi-tagged | +Inquiry |
GHRH-200H | Recombinant Human Growth Hormone Releasing Hormone | +Inquiry |
GHRH-2868H | Recombinant Human GHRH Protein (Pro21-Leu75), C-Fc tagged | +Inquiry |
GHRH-13251H | Recombinant Human GHRH, His-tagged | +Inquiry |
◆ Native Proteins | ||
GHRH-37H | Active Native Human GHRH | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHRH-704HCL | Recombinant Human GHRH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHRH Products
Required fields are marked with *
My Review for All GHRH Products
Required fields are marked with *