Recombinant Sheep GHRH Protein (1-44 aa), GST-tagged

• Cat.No.: GHRH-523S
• Product Overview: Recombinant Sheep GHRH Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Description: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
• Source: E. coli
• Species: Sheep
• Tag: GST
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 32.1 kDa
• Protein length: 1-44 aa
• AA Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: GHRH growth hormone releasing hormone [ Ovis aries (sheep) ]
• Official Symbol: GHRH
• Synonyms: GRF
• Gene ID: 100101237
• UniProt ID: P07217

Reviews

08/24/2017

GHRH is extensively used in protein electron microscopy structure analysis due to its compatibility with this technique, providing crucial insights into molecular architectures.

03/05/2017

One aspect that sets the GHRH Protein apart is the excellent technical support provided by the manufacturer.

09/13/2016

I have found the GHRH Protein to be highly stable, enabling long-term experiments without compromising its performance.

Q&As

Is GHRH therapy only used for growth-related issues?

No, it's also being explored for its potential in other conditions like muscle wasting diseases and cognitive disorders.

How long does it usually take to see the effects of GHRH therapy?

Effects on growth may take several months to become noticeable, depending on the individual and the underlying condition.

How does GHRH affect the body?

It stimulates the pituitary gland to release growth hormone, which regulates growth, metabolism, and body composition.

What conditions can benefit from GHRH therapy?

GHRH therapy is beneficial for children with growth hormone deficiencies and adults with certain growth hormone-related disorders.

Are there any age restrictions for GHRH therapy?

Typically, it's used in children and adults with specific hormone deficiencies or growth-related conditions.