Recombinant Sortase Protein, His-tagged
| Cat.No. : | Sortase-162 |
| Product Overview : | Recombinant Sortase fused with His tag was produced in E. coli. |
| Availability | April 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Form : | Liquid. In 1XPBS pH7.4 |
| Molecular Mass : | (Theoretical molecular weight) ~20.8 kDa |
| AA sequence : | MGHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAKENASLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVK |
| Purity : | >95% as determined by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 1.2mg/ml |
| ◆ Recombinant Proteins | ||
| Sortase-162 | Recombinant Sortase Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sortase Products
Required fields are marked with *
My Review for All Sortase Products
Required fields are marked with *
0
Inquiry Basket
