"Sortase" Related Products

    Recombinant Sortase Protein, His-tagged

    Cat.No. : Sortase-162
    Product Overview : Recombinant Sortase fused with His tag was produced in E. coli.
    Source : E. coli
    Tag : His
    Form : Liquid. In 1XPBS pH7.4
    Molecular Mass : (Theoretical molecular weight) ~20.8 kDa
    AA sequence : MGHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAKENASLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVK
    Purity : >95% as determined by SDS-PAGE
    Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
    Concentration : 1.2mg/ml
    Figure :

    Online Inquiry

    Note: There will be extra charge for optional service!

    Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

    Optional requirements on this protein    +Expand

    Price Inquiry

    Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.