Recombinant Staphylococcus Aureus TST Protein (41-234 aa), His-SUMO-tagged
Cat.No. : | TST-1773S |
Product Overview : | Recombinant Staphylococcus Aureus TST Protein (41-234 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Aureus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 41-234 aa |
Description : | Responsible for the symptoms of toxic shock syndrome. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.9 kDa |
AA Sequence : | STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | tst; TSST-1; |
UniProt ID | P06886 |
◆ Recombinant Proteins | ||
TST-5989R | Recombinant Rat TST Protein, His (Fc)-Avi-tagged | +Inquiry |
TST-2844H | Recombinant Human TST Protein, MYC/DDK-tagged | +Inquiry |
TST-1773S | Recombinant Staphylococcus Aureus TST Protein (41-234 aa), His-SUMO-tagged | +Inquiry |
Tst-6701M | Recombinant Mouse Tst Protein, Myc/DDK-tagged | +Inquiry |
TST-6333R | Recombinant Rat TST Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TST-1849HCL | Recombinant Human TST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TST Products
Required fields are marked with *
My Review for All TST Products
Required fields are marked with *
0
Inquiry Basket