Recombinant Streptomyces avidinii Streptavidin protein, GST-tagged
Cat.No. : | Streptavidin-3981S |
Product Overview : | Recombinant Streptomyces avidinii Streptavidin protein(P22629)(25-183aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces avidinii |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-183aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Streptavidin-07 | Recombinant Streptomyces avidinii Streptavidin, His tagged, Cys Labeled | +Inquiry |
Streptavidin-930S | Streptavidin(C-line) | +Inquiry |
Streptavidin-2939S | Core Streptavidin | +Inquiry |
Streptavidin-3981S | Recombinant Streptomyces avidinii Streptavidin protein, GST-tagged | +Inquiry |
STRPE-01 | Streptavidin, Phycoerythrin labelled | +Inquiry |
◆ Native Proteins | ||
Streptavidin-05S | Active Native Streptomyces avidinii Streptavidin | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
Streptavidin-016 | Native Streptomyces avidinii Streptavidin, Gold conjugated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Streptavidin Products
Required fields are marked with *
My Review for All Streptavidin Products
Required fields are marked with *