Recombinant Thauera selenatis TXNRD1 Protein

Cat.No. : TXNRD1-109T
Product Overview : Recombinant Thauera selenatis TXNRD1 Protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Thauera selenatis
Source : E.coli
Description : The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.
Form : PBS, pH 7.4.
Molecular Mass : 25.5 kDa
AA Sequence : MHHHHHHHHHHADGAPAAQRTIQVLSVKGGDAASPQAAVWKKAPTGQVALQTAFPGHASIVGTALTQQMTAQAVRAGDRLFVRLAWRDATANTEIKDTDQFVDGAAVQFPVNGKDTTLAFMGDPDNPVNVWHWRADGRTRNLVAKGFGTATPVPAEGLRSTATRTRDGWEVVISRPLRVKAEEGADLQGRRTMPIAFAAWDGENQERDGLKAVTMEWWQLNFEQKLISEEDL
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.35 mg/mL
Official Symbol TXNRD1
Synonyms TR; TR1; TXNR; TRXR1; GRIM-12; TR; TR1; TXNR; TRXR1; GRIM-12
UniProt ID Q9S1G7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXNRD1 Products

Required fields are marked with *

My Review for All TXNRD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon