Recombinant Vaccinia Virus B18R Protein, His-tagged
Cat.No. : | B18R-755V |
Product Overview : | Recombinant Vaccinia Virus B18R protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | HEK293 |
Tag : | His |
Protein Length : | 351 |
Description : | The B18R protein is a vaccinia virus-encoded receptor with specificity for mouse, human, rabbit, pig, rat, and cow type I interferons which has potent neutralizing activity. B18R that acts as a decoy receptor for Type I Interferons (IFNa, IFNb, IFNe,k,t,d,z,w,v). B18R was recently identified to enable increased cell viability during RNA transfection protocols designed to convert human somatic donor cells into iPSCs via direct delivery of modified synthetic mRNAs for OCT4, SOX2, KLF4 and MYC (OSKM) and Lin28 with the aim to enable highly efficient reprogramming of somatic cells to pluripotency. This allows for re-directed differentiation toward a desired lineage while removing the risk of genomic integration and insertional mutagenesis inherent to DNA-bases methodologies and eliminates the need for virus-based approaches. iPSCs represent a widely available, non-controversial and practically infinite source of pluripotent cells. |
Form : | Lyophilized |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MTMKMMVHIYFVSLLLLLFHSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Official Symbol | B18R |
Synonyms | VACWR200; B18R |
◆ Recombinant Proteins | ||
B18R-755V | Recombinant Vaccinia Virus B18R Protein, His-tagged | +Inquiry |
MPXV-0237 | Recombinant Monkeypox Virus B18R Protein, B18R (Kelch-like Protein) | +Inquiry |
B18R-174 | Active Recombinant Viral B18R Protein | +Inquiry |
B19R-641V | Recombinant Vaccinia virus B18R Protein, His-tagged | +Inquiry |
MPXV-0235 | Recombinant Monkeypox Virus B18R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
B18R-001VCL | Recombinant Vaccinia Virus B18R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B18R Products
Required fields are marked with *
My Review for All B18R Products
Required fields are marked with *
0
Inquiry Basket