Recombinant Vaccinia Virus L1R Protein (2-183 aa), His-tagged
Cat.No. : | L1R-2603V |
Product Overview : | Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) L1R Protein (2-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-183 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.8 kDa |
AA Sequence : | GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | L1R temporal expression: late [ Vaccinia virus ] |
Official Symbol | L1R |
Synonyms | VACWR088; |
Gene ID | 3707544 |
Protein Refseq | YP_232970 |
UniProt ID | P07612 |
◆ Recombinant Proteins | ||
MPXV-0616 | Recombinant Monkeypox Virus L1R Protein, Virion morphogenesis | +Inquiry |
MPXV-0613 | Recombinant Monkeypox Virus L1R Protein | +Inquiry |
L1R-2603V | Recombinant Vaccinia Virus L1R Protein (2-183 aa), His-tagged | +Inquiry |
MPXV-0614 | Recombinant Monkeypox Virus L1R Protein, MPXVgp085 | +Inquiry |
RFL35565VF | Recombinant Full Length Variola Virus Protein L1 (L1R) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All L1R Products
Required fields are marked with *
My Review for All L1R Products
Required fields are marked with *
0
Inquiry Basket