Recombinant Vaccinia virus (strain Copenhagen) L1R protein, His&Myc-tagged
| Cat.No. : | L1R-4351V |
| Product Overview : | Recombinant Vaccinia virus (strain Copenhagen) L1R protein(P20540)(2-183aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | VACV |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-183aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.8 kDa |
| AA Sequence : | GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| L1R-3242M | Recombinant Monkeypox Virus L1R protein, His-tagged | +Inquiry |
| OPG100-261M | Recombinant Monkeypox Virus L1R Protein, His-tagged(C-ter) | +Inquiry |
| L1R-5907V | Recombinant VACV L1R protein, His&Myc-tagged | +Inquiry |
| L1R-2603V | Recombinant Vaccinia Virus L1R Protein (2-183 aa), His-tagged | +Inquiry |
| MPXV-0614 | Recombinant Monkeypox Virus L1R Protein, MPXVgp085 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L1R Products
Required fields are marked with *
My Review for All L1R Products
Required fields are marked with *




