Species : |
VARV |
Source : |
Yeast |
Tag : |
His |
Protein Length : |
1-110 aa |
Description : |
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. |
Form : |
Tris-based buffer,50% glycerol |
Molecular Mass : |
14.5 kDa |
AA Sequence : |
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
Purity : |
> 85% as determined by SDS-PAGE. |
Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : |
A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |