Recombinant Variola Virus A27L Protein (1-110 aa), His-tagged

Cat.No. : A27L-2443V
Product Overview : Recombinant Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus) A27L Protein (1-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : VARV
Source : Yeast
Tag : His
Protein Length : 1-110 aa
Description : Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.5 kDa
AA Sequence : MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms A27L;
UniProt ID P33816

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All A27L Products

Required fields are marked with *

My Review for All A27L Products

Required fields are marked with *

0
cart-icon
0
compare icon