Recombinant Vibrio Parahaemolyticus Serotype O3:K6 OMPK Protein (21-266 aa), His-SUMO-tagged
Cat.No. : | OMPK-1885V |
Product Overview : | Recombinant Vibrio Parahaemolyticus Serotype O3:K6 (strain RIMD 2210633) OMPK Protein (21-266 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Parahaemolyticus Serotype O3:K6 |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-266 aa |
Description : | Serves as receptor for a broad-host-range vibriophage, KVP40. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.9 kDa |
AA Sequence : | ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | ompK; |
UniProt ID | P59570 |
◆ Recombinant Proteins | ||
OMPK-1885V | Recombinant Vibrio Parahaemolyticus Serotype O3:K6 OMPK Protein (21-266 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OMPK Products
Required fields are marked with *
My Review for All OMPK Products
Required fields are marked with *
0
Inquiry Basket