Recombinant VSIV(strain Glasgow) Matrix protein, His-tagged
Cat.No. : | Matrix-791V |
Product Overview : | Recombinant VSIV(strain Glasgow) Matrix protein(P04876)(1-237aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VSIV |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-237aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Matrix-201V | Recombinant SARS Coronavirus Matrix (Membrane) protein | +Inquiry |
Matrix-787V | Recombinant VSIV(strain Glasgow) Matrix protein, His-Myc-tagged | +Inquiry |
Matrix-789V | Recombinant VSIV(strain Glasgow) Matrix protein, His-tagged | +Inquiry |
Matrix-792V | Recombinant VSIV(strain San Juan) Matrix protein, His-Myc-tagged | +Inquiry |
Matrix-791V | Recombinant VSIV(strain Glasgow) Matrix protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Matrix Products
Required fields are marked with *
My Review for All Matrix Products
Required fields are marked with *