Recombinant Wheat PLTP protein, His-SUMO-tagged
Cat.No. : | PLTP-3660W |
Product Overview : | Recombinant Wheat PLTP protein(P24296)(25-113aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Wheat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-113aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
PLTP-2600H | Recombinant Human PLTP Protein, His-tagged | +Inquiry |
PLTP-3781H | Recombinant Human PLTP protein, His-tagged | +Inquiry |
PLTP-380HF | Recombinant Full Length Human PLTP Protein | +Inquiry |
PLTP-3660W | Recombinant Wheat PLTP protein, His-SUMO-tagged | +Inquiry |
Pltp-5633M | Recombinant Mouse Pltp protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLTP-2065HCL | Recombinant Human PLTP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLTP Products
Required fields are marked with *
My Review for All PLTP Products
Required fields are marked with *