Recombinant Yellow Fluorescent Protein

Cat.No. : YFP-01
Product Overview : The recombinant YFP (Yellow Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal YFP fluorescence. Endotoxin has been removed, so the protein is suitable for in vivo injection or cell culture applications.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : Non
Description : The protein is a 26.4 kDa monomer with 238 amino acids, Ex./Em. = 525/538 nm, extinction coefficient 27390
Form : Freeze Dried
Molecular Mass : 26.4 KDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKD FYKSCMPDGYVQERTITEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMN TPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYL
Endotoxin : Less than 0.1 ng/μg
Purity : Greater than 97% by SDS-PAGE and HPLC
Applications : The protein is suitable as control reagent for YFP expression studies or as labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of YFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of YFP into cells and tissues, etc. The recombinant YFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP and RFP.
Storage : -80 °C for long-term storage
Reconstitution : Reconstitute with dH?O to 1 mg/ml

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YFP Products

Required fields are marked with *

My Review for All YFP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon