Recombinant Zebrafish VWC2L Protein (22-223 aa), His-Myc-tagged
Cat.No. : | VWC2L-2465Z |
Product Overview : | Recombinant Zebrafish (Danio rerio) (Brachydanio rerio) VWC2L Protein (22-223 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the C-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 22-223 aa |
Description : | May play a role in bone differentiation and matrix mineralization. May play a role in neural development. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.4 kDa |
AA Sequence : | ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | vwc2l von Willebrand factor C domain containing 2 like [ Danio rerio (zebrafish) ] |
Official Symbol | VWC2L |
Synonyms | vwc2l; si:ch211-207d8.1; |
Gene ID | 100148652 |
mRNA Refseq | NM_001128564 |
Protein Refseq | NP_001122036 |
UniProt ID | B0UZC8 |
◆ Recombinant Proteins | ||
VWC2L-1817H | Recombinant Human VWC2L | +Inquiry |
VWC2L-2465Z | Recombinant Zebrafish VWC2L Protein (22-223 aa), His-Myc-tagged | +Inquiry |
VWC2L-2350H | Recombinant Human VWC2L Protein, His (Fc)-Avi-tagged | +Inquiry |
VWC2L-1837HFL | Recombinant Full Length Human VWC2L Protein, C-Flag-tagged | +Inquiry |
VWC2L-584H | Recombinant Human VWC2L Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWC2L Products
Required fields are marked with *
My Review for All VWC2L Products
Required fields are marked with *