Recombinant Zebrafish VWC2L Protein (22-223 aa), His-Myc-tagged
| Cat.No. : | VWC2L-2465Z |
| Product Overview : | Recombinant Zebrafish (Danio rerio) (Brachydanio rerio) VWC2L Protein (22-223 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the C-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 22-223 aa |
| Description : | May play a role in bone differentiation and matrix mineralization. May play a role in neural development. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.4 kDa |
| AA Sequence : | ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | vwc2l von Willebrand factor C domain containing 2 like [ Danio rerio (zebrafish) ] |
| Official Symbol | VWC2L |
| Synonyms | vwc2l; si:ch211-207d8.1; |
| Gene ID | 100148652 |
| mRNA Refseq | NM_001128564 |
| Protein Refseq | NP_001122036 |
| UniProt ID | B0UZC8 |
| ◆ Recombinant Proteins | ||
| VWC2L-1817H | Recombinant Human VWC2L | +Inquiry |
| VWC2L-2465Z | Recombinant Zebrafish VWC2L Protein (22-223 aa), His-Myc-tagged | +Inquiry |
| VWC2L-2350H | Recombinant Human VWC2L Protein, His (Fc)-Avi-tagged | +Inquiry |
| VWC2L-1837HFL | Recombinant Full Length Human VWC2L Protein, C-Flag-tagged | +Inquiry |
| VWC2L-584H | Recombinant Human VWC2L Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWC2L Products
Required fields are marked with *
My Review for All VWC2L Products
Required fields are marked with *
