| Source : |
E.coli |
| Tag : |
His |
| AASequence : |
ADHHRGACGGGGGYGDLCRGGGMHGCAQQQQKQGAMMCALKAATAATFGGSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGCHPPGADCLDHAKARLASCARDIKDAAQHCIDQAQGS |
| Molecular Mass : |
17 kDa |
| Purity : |
≥95% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : |
Lyophilized from PBS,0.05% Brij-78, 6% Trehalose, pH 7.4
The volume before lyophilization is 137 μL/vial. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
