Recombinant ZmOleCys, His tagged

Cat.No. : ZmOleCys-07
Product Overview : Recombinant ZmOleCys with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
AASequence : ADHHRGACGGGGGYGDLCRGGGMHGCAQQQQKQGAMMCALKAATAATFGGSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGCHPPGADCLDHAKARLASCARDIKDAAQHCIDQAQGS
Molecular Mass : 17 kDa
Purity : ≥95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from PBS,0.05% Brij-78, 6% Trehalose, pH 7.4 The volume before lyophilization is 137 μL/vial.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Official Symbol ZmOleCys
Synonyms ZmOleCys

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZmOleCys Products

Required fields are marked with *

My Review for All ZmOleCys Products

Required fields are marked with *

0
cart-icon
0
compare icon