Recombinant ZmOleCys, His tagged
| Cat.No. : | ZmOleCys-07 |
| Product Overview : | Recombinant ZmOleCys with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| AASequence : | ADHHRGACGGGGGYGDLCRGGGMHGCAQQQQKQGAMMCALKAATAATFGGSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGCHPPGADCLDHAKARLASCARDIKDAAQHCIDQAQGS |
| Molecular Mass : | 17 kDa |
| Purity : | ≥95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from PBS,0.05% Brij-78, 6% Trehalose, pH 7.4 The volume before lyophilization is 137 μL/vial. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Official Symbol | ZmOleCys |
| Synonyms | ZmOleCys |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZmOleCys Products
Required fields are marked with *
My Review for All ZmOleCys Products
Required fields are marked with *



