Synthesized Human HMSDV Peptide
| Cat.No. : | HMSDV-001H |
| Product Overview : | Synthesized Human HMSDV |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Synthesized |
| Protein Length : | 1-53 aa |
| Form : | White powder |
| Molecular Mass : | 6023.1± 1.0 |
| AASequence : | MEIFIEVFSHFLLQLTELTLNMCLELPTGSLEKSLMISSQVLQIPVANSTKQR |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | NLT 95.0% |
| Storage : | Store at -20 centigrade. |
| Solubility : | Soluble in DMSO |
| Official Symbol | HMSDV |
| Synonyms | HMSDV |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMSDV Products
Required fields are marked with *
My Review for All HMSDV Products
Required fields are marked with *
Recently Viewed
