Synthesized Human SMIM20 Peptide

• Cat.No.: SMIM20-001H
• Product Overview: Synthesized Human SMIM20 CH3COO- %: 6.476% CF3COO- %: 0.592%

Specification

• Species: Human
• Source: Synthesized
• Protein Length: 28-67 aa
• Description: Involved in mitochondrial cytochrome c oxidase assembly. Located in mitochondrial inner membrane.
• Form: Lyophilized material
• Molecular Mass: Molecular Weight (by MS, [M+3H]3+): 1560.70 Molecular Weight (by MS, [M+4H]4+): 1170.90 Molecular Weight (by MS, [M+5H]5+): 937.00 Molecular Weight (by MS, [M+6H]6+): 781.00 Molecular Weight (by MS, [M+7H]7+): 669.60 Molecular Weight (by MS, [M+8H]8+): 586.05
• AASequence: RPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
• Endotoxin: < 1 EU/μg by LAL
• Purity: 96.92% (HPLC, 220 nm, C18, linear gradient)
• Storage: Store at -20 centigrade.
• Molecular formula: C209H337N61O59S1
• Molecule Mass: 4680.35

Gene Information

• Gene Name: SMIM20 small integral membrane protein 20 [ Homo sapiens (human) ]
• Official Symbol: SMIM20
• Synonyms: SMIM20; small integral membrane protein 20; PNX; C4orf52; MITRAC7; small integral membrane protein 20; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 7 kDa; phoenixin
• Gene ID: 389203
• mRNA Refseq: NM_001394130
• Protein Refseq: NP_001381059
• MIM: 617465
• UniProt ID: Q8N5G0