Synthetic Human Brain Natriuretic Peptide 32

Cat.No. : NPPB-8050H
Product Overview : Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
Molecular Formula: C143H244N50O42S4
Disulfide bridge: Cys10-Cys26
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Molecular Mass : 3464.1
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Purity : > 95%
Storage : Store the peptide at -20 centigrade.
Gene Name NPPB natriuretic peptide B [ Homo sapiens (human) ]
Official Symbol NPPB
Synonyms NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
Gene ID 4879
mRNA Refseq NM_002521
Protein Refseq NP_002512
MIM 600295
UniProt ID P16860

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPPB Products

Required fields are marked with *

My Review for All NPPB Products

Required fields are marked with *

0
cart-icon