Recombinant Human GDNF protein, Fc/His-tagged
| Cat.No. : | GDNF-7293H |
| Product Overview : | Recombinant Human GDNF(Phe20-Ile211) fused with Fc and His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | Phe20-Ile211 |
| Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
| AA Sequence : | FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMA VLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSC DAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIVDD IEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | GDNF glial cell derived neurotrophic factor [ Homo sapiens ] |
| Official Symbol | GDNF |
| Synonyms | GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; astrocyte derived trophic factor; ATF1; ATF2; glial cell line derived neurotrophic factor; glial derived neurotrophic factor; HFB1 GDNF; ATF; astrocyte-derived trophic factor; HSCR3; HFB1-GDNF; |
| Gene ID | 2668 |
| mRNA Refseq | NM_000514 |
| Protein Refseq | NP_000505 |
| MIM | 600837 |
| UniProt ID | P39905 |
| Chromosome Location | 5p13.1-p12 |
| Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; NCAM signaling for neurite out-growth, organism-specific biosystem; NCAM1 interactions, organism-specific biosystem; Signaling events regulated by Ret tyrosine kinase, organism-specific biosystem; |
| Function | growth factor activity; protein homodimerization activity; receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *



