Active GMP Recombinant Human IL19 protein
Cat.No. : | IL19-4332HG |
Product Overview : | Recombinant Human IL19 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Human Interleukin-19 (IL-19) is encoded by the IL19 gene, which is located on the chromosome 1. The protein belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10^5 IU/mg. |
Molecular Mass : | Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
AA Sequence : | LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA |
Endotoxin : | Less than 1 EU/µg of rHuIL-19 as determined by LAL method. |
Purity : | > 95 % by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL19 interleukin 19 [ Homo sapiens (human) ] |
Official Symbol | IL19 |
Synonyms | MDA1; NG.1; ZMDA1; IL-10C; Melanoma Differentiation-associated Protein-like Protein, NG.1 |
Gene ID | 29949 |
mRNA Refseq | NM_153758.2 |
Protein Refseq | NP_715639.1 |
MIM | 605687 |
UniProt ID | Q9UHD0 |
◆ Cell & Tissue Lysates | ||
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL19 Products
Required fields are marked with *
My Review for All IL19 Products
Required fields are marked with *
0
Inquiry Basket