Active GMP Recombinant Human TGFB1 Protein
Cat.No. : | TGFB1-159HG |
Product Overview : | Recombinant Human TGFB1 (Ala279-Ser390) was produced in HEK293 cell with an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Protein Length : | 279-390 a.a. |
Description : | Transforming Growth Factor β-1 (TGFβ-1) is a secreted protein which belongs to the TGF-β family. TGFβ-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGFβ-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGFβ-1 peptide. TGFβ-1 may also form heterodimers with other TGFβ family members. It has been found that TGFβ-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease. |
Form : | Lyophilized. |
Bio-activity : | >2.0x10^7 U/mg |
AA Sequence : | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Residual Host Cell DNA Content : | <10pg/mg |
Residual Host Cell Protein Content : | <1ug/mg |
Endotoxin : | <0.1EU/ug |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
Official Symbol | TGFB1 |
Synonyms | TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; LAP; DPD1; TGFB |
Gene ID | 7040 |
mRNA Refseq | NM_000660 |
Protein Refseq | NP_000651 |
MIM | 190180 |
UniProt ID | P01137 |
◆ Recombinant Proteins | ||
TGFB1-299H | Recombinant Active Human TGFB1 Protein, His-tagged(C-ter) | +Inquiry |
TGFB1-525D | Recombinant Dog TGFB1 protein, His & GST-tagged | +Inquiry |
TGFB1-153H | Active Recombinant Human TGFB1 Protein | +Inquiry |
TGFB1-1250H | Recombinant Human TGFB1 Protein, His-tagged | +Inquiry |
TGFB1-532R | Recombinant Rabbit TGFB1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
0
Inquiry Basket