Active GMP Recombinant Mouse Ccl3 Protein, His-Tagged

• Cat.No.: Ccl3-01M
• Product Overview: GMP Recombinant Mouse Ccl3 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Enables chemokine activity. Involved in several processes, including astrocyte cell migration; macrophage chemotaxis; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in articular cartilage; cartilage; knee joint; lung; and radius. Human ortholog(s) of this gene implicated in human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL3 (C-C motif chemokine ligand 3).
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <1.8 ng/mL.
• AA Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl3
• Synonyms: G0S19-1, LD78alpha, MIP-1alpha, MIP1-(a), MIP1-alpha, Mip1a, Scya3
• Gene ID: 20302
• mRNA Refseq: NM_011337.2
• Protein Refseq: NP_035467.1
• UniProt ID: P10855