Active GMP Recombinant Mouse Ccl3 Protein, His-Tagged

Cat.No. : Ccl3-01M
Product Overview : GMP Recombinant Mouse Ccl3 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables chemokine activity. Involved in several processes, including astrocyte cell migration; macrophage chemotaxis; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in articular cartilage; cartilage; knee joint; lung; and radius. Human ortholog(s) of this gene implicated in human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL3 (C-C motif chemokine ligand 3).
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <1.8 ng/mL.
AA Sequence : APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ]
Official Symbol Ccl3
Synonyms G0S19-1, LD78alpha, MIP-1alpha, MIP1-(a), MIP1-alpha, Mip1a, Scya3
Gene ID 20302
mRNA Refseq NM_011337.2
Protein Refseq NP_035467.1
UniProt ID P10855

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl3 Products

Required fields are marked with *

My Review for All Ccl3 Products

Required fields are marked with *

0
cart-icon
0
compare icon