Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
Enables chemokine activity. Involved in several processes, including astrocyte cell migration; macrophage chemotaxis; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in articular cartilage; cartilage; knee joint; lung; and radius. Human ortholog(s) of this gene implicated in human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL3 (C-C motif chemokine ligand 3). |
Form : |
Lyophilized |
Bio-activity : |
Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <1.8 ng/mL. |
AA Sequence : |
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus |
Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : |
Please use within one month after protein reconstitution. |
Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |