Active GMP Recombinant Mouse Csf1 Protein, His-Tagged

• Cat.No.: Csf1-01M
• Product Overview: GMP Recombinant Mouse Csf1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Macrophage Colony-Stimulating Factor (M-CSF), is a secreted cytokine which causes hematopoietic stem cells to differentiate into macrophages or other related cell types. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It also plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Upregulation of M-CSF/CSF-1 in the infarcted myocardium may have an active role in healing not only through its effects on cells of monocyte/macrophage lineage, but also by regulating endothelial cell chemokine expression.
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5x 10^5 IU/mg.
• AA Sequence: MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSC
  FTKDYEEQNKACVRTFHETPLQLLEKIKNFFDETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Mus musculus (house mouse) ]
• Official Symbol: Csf1
• Synonyms: op; Csfm; MCSF; BAP025; Mhdabap25
• Gene ID: 12977
• mRNA Refseq: NM_001113529.1
• Protein Refseq: NP_001107001.1
• UniProt ID: P07141