Active GMP Recombinant Mouse Csf1 Protein, His-Tagged

Cat.No. : Csf1-01M
Product Overview : GMP Recombinant Mouse Csf1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Macrophage Colony-Stimulating Factor (M-CSF), is a secreted cytokine which causes hematopoietic stem cells to differentiate into macrophages or other related cell types. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It also plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Upregulation of M-CSF/CSF-1 in the infarcted myocardium may have an active role in healing not only through its effects on cells of monocyte/macrophage lineage, but also by regulating endothelial cell chemokine expression.
Form : Lyophilized
Bio-activity : Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5x 10^5 IU/mg.
AA Sequence : MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSC
FTKDYEEQNKACVRTFHETPLQLLEKIKNFFDETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Csf1 colony stimulating factor 1 (macrophage) [ Mus musculus (house mouse) ]
Official Symbol Csf1
Synonyms op; Csfm; MCSF; BAP025; Mhdabap25
Gene ID 12977
mRNA Refseq NM_001113529.1
Protein Refseq NP_001107001.1
UniProt ID P07141

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf1 Products

Required fields are marked with *

My Review for All Csf1 Products

Required fields are marked with *

0
cart-icon