Active GMP Recombinant Mouse Cxcl10 Protein, His-Tagged

Cat.No. : Cxcl10-01M
Product Overview : GMP Recombinant Mouse Cxcl10 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable chemoattractant activity; chemokine receptor binding activity; and heparin binding activity. Acts upstream of or within several processes, including defense response to virus; negative regulation of myoblast differentiation; and negative regulation of myoblast fusion. Located in external side of plasma membrane and extracellular space. Is expressed in several structures, including alimentary system; axial skeleton; hemolymphoid system; and liver. Human ortholog(s) of this gene implicated in hepatitis B; middle cerebral artery infarction; and type 1 diabetes mellitus. Orthologous to human CXCL10 (C-X-C motif chemokine ligand 10).
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 μg/mL.
AA Sequence : IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Cxcl10 chemokine (C-X-C motif) ligand 10 [ Mus musculus (house mouse) ]
Official Symbol Cxcl10
Synonyms C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
Gene ID 15945
mRNA Refseq NM_021274.2
Protein Refseq NP_067249.1
UniProt ID P17515

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl10 Products

Required fields are marked with *

My Review for All Cxcl10 Products

Required fields are marked with *

0
cart-icon