Active GMP Recombinant Mouse Cxcl12 Protein, His-Tagged
Cat.No. : | Cxcl12-01M |
Product Overview : | GMP Recombinant Mouse Cxcl12 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is <0.5 ng/mL. |
AA Sequence : | MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl12 |
Synonyms | Pbsf; Sdf1; Tlsf; Tpar1; Scyb12 |
Gene ID | 20315 |
mRNA Refseq | NM_001012477.2 |
Protein Refseq | NP_001012495.1 |
UniProt ID | A0A6P7RBN4 |
◆ Recombinant Proteins | ||
Cxcl12-11719M | Recombinant mouse Cxcl12, GST-tagged | +Inquiry |
CXCL12-110F | Recombinant Feline Chemokine (C-X-C Motif) Ligand 12(SDF-1b) | +Inquiry |
CXCL12-57H | Active Recombinant Full Length Human CXCL12 gamma Protein, Non-tagged | +Inquiry |
CXCL12-192H | Recombinant Human CXCL12 Protein, DYKDDDDK-tagged | +Inquiry |
CXCL12-1166R | Active Recombinant Rhesus CXCL12 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl12 Products
Required fields are marked with *
My Review for All Cxcl12 Products
Required fields are marked with *
0
Inquiry Basket