Active GMP Recombinant Mouse Cxcl12 Protein, His-Tagged

Cat.No. : Cxcl12-01M
Product Overview : GMP Recombinant Mouse Cxcl12 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants.
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is <0.5 ng/mL.
AA Sequence : MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus (house mouse) ]
Official Symbol Cxcl12
Synonyms Pbsf; Sdf1; Tlsf; Tpar1; Scyb12
Gene ID 20315
mRNA Refseq NM_001012477.2
Protein Refseq NP_001012495.1
UniProt ID A0A6P7RBN4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl12 Products

Required fields are marked with *

My Review for All Cxcl12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon