Active GMP Recombinant Mouse Cxcl3 Protein, His-Tagged
Cat.No. : | Cxcl3-01M |
Product Overview : | GMP Recombinant Mouse Cxcl3 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <80 ng/mL. |
AA Sequence : | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Cxcl3 chemokine (C-X-C motif) ligand 3 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl3 |
Synonyms | Dcip1; Gm1960 |
Gene ID | 330122 |
mRNA Refseq | NM_203320.3 |
Protein Refseq | NP_976065.1 |
UniProt ID | Q6W5C0 |
◆ Recombinant Proteins | ||
CXCL3-4106M | Recombinant Mouse CXCL3 Protein | +Inquiry |
Cxcl3-627R | Recombinant Rat Cxcl3 protein | +Inquiry |
CXCL3-935R | Recombinant Rhesus Macaque CXCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcl3-5250M | Recombinant Mouse Cxcl3 protein, His-tagged | +Inquiry |
CXCL3-234H | Active Recombinant Mouse Chemokine (C-X-C motif) Ligand 3, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl3 Products
Required fields are marked with *
My Review for All Cxcl3 Products
Required fields are marked with *
0
Inquiry Basket