Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
Enables growth factor activity. Involved in stem cell development. Acts upstream of or within several processes, including animal organ development; positive regulation of macromolecule metabolic process; and positive regulation of signal transduction. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; extraembryonic component; genitourinary system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism; corneal neovascularization; diabetic neuropathy; gastric ulcer; and impotence. Orthologous to human FGF2 (fibroblast growth factor 2). |
Form : |
Lyophilized |
Bio-activity : |
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <1.5 ng/mL. The specific activity of recombinant mouse FGF-2 is approximately >1x 10^6 IU/mg. |
AA Sequence : |
ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFF FERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus |
Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
Purity : |
≥98% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
Notes : |
Please use within one month after protein reconstitution. |
Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : |
The protein was lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 8.0. |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |