| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Predicted to enable fibroblast growth factor receptor binding activity and growth factor activity. Involved in positive regulation of cold-induced thermogenesis. Acts upstream of or within positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including alimentary system; cerebellum; integumental system; limb; and skeleton. Orthologous to human FGF21 (fibroblast growth factor 21) |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to induce proliferation in NIH‑3T3 mouse embryonic fibroblast cells in the presence of mouse Klotho beta and heparin. The ED50 for this effect is < 2 μg/mL. |
| AA Sequence : |
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS with polyhistidine tag at the N-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |