Active GMP Recombinant Mouse Fgf21 Protein, His-Tagged

Cat.No. : Fgf21-01M
Product Overview : GMP Recombinant Mouse Fgf21 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable fibroblast growth factor receptor binding activity and growth factor activity. Involved in positive regulation of cold-induced thermogenesis. Acts upstream of or within positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including alimentary system; cerebellum; integumental system; limb; and skeleton. Orthologous to human FGF21 (fibroblast growth factor 21)
Form : Lyophilized
Bio-activity : Measure by its ability to induce proliferation in NIH‑3T3 mouse embryonic fibroblast cells in the presence of mouse Klotho beta and heparin. The ED50 for this effect is < 2 μg/mL.
AA Sequence : AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Fgf21 fibroblast growth factor 21 [ Mus musculus (house mouse) ]
Official Symbol Fgf21
Synonyms Fgf8c
Gene ID 56636
mRNA Refseq NM_020013.4
Protein Refseq NP_064397.1
UniProt ID Q9JJN1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf21 Products

Required fields are marked with *

My Review for All Fgf21 Products

Required fields are marked with *

0
cart-icon
0
compare icon