Active GMP Recombinant Porcine IL10 Protein, His-Tagged
| Cat.No. : | IL10-01P |
| Product Overview : | GMP Recombinant Porcine IL10 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Porcine |
| Source : | E.coli |
| Tag : | His |
| Description : | Interleukin 10 (IL-10), also known as human cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine. In humans, interleukin 10 is encoded by the IL10 gene. IL-10 signals through a receptor complex consisting of two IL-10 receptor-1 and two IL-10 receptor-2 proteins. Consequently, the functional receptor consists of four IL-10 receptor molecules. IL-10 binding induces STAT3 signalling via the phosphorylation of the cytoplasmic tails of IL-10 receptor 1 + IL-10 receptor 2 by JAK1 and Tyk2 respectively. |
| Form : | Lyophilized |
| Bio-activity : | Measure by its ability to induce proliferation in MC/9‑2 cells. The ED50 for this effect is <5 ng/mL. |
| AA Sequence : | MSIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : | Please use within one month after protein reconstitution. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Gene Name | IL10 interleukin 10 [ Sus scrofa (pig) ] |
| Official Symbol | IL10 |
| Synonyms | CSIF; IL-10 |
| Gene ID | 397106 |
| mRNA Refseq | NM_214041.1 |
| Protein Refseq | NP_999206.1 |
| UniProt ID | Q29055 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *



